Is Florida Testing For Viruse And Antibody Results

Custom ELISA testing for anthrax antibodies in animal and human samples (vaccinated or normal)

900-100-CUX Custom Ask for price

Human IgG antibody Laboratories manufactures the is florida testing for viruse and antibody results reagents distributed by Genprice. The Is Florida Testing For Viruse And Antibody Results reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact virus Antibody. Other Is products are available in stock. Specificity: Is Category: Florida Group: Testing For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Testing For information

Influenza B Virus Florida 04/06

7-07923 1mg Ask for price

TruStrip RDT Chloramphenicol rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100040-RDT 1 pk
EUR 781.2

TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100060-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (AHD rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100070-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (SEM) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100075-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100080-RDT 1 pk
EUR 781.2

TruStrip RDT Malachite green rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100280-RDT 1 pk Ask for price

TruStrip RDT Total Aflatoxins rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100300-RDT 1 pk Ask for price

TruStrip RDT Sulfonamides residues (SAs) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100090-RDT 1 pk
EUR 781.2

Influenza B Virus Florida 07 / 04 Protein

20-abx260511
  • EUR 276.00
  • EUR 3082.80
  • EUR 393.60
  • 10 ug
  • 1 mg
  • 50 ug

Influenza B Virus Florida 04 / 06 Protein

20-abx260512
  • EUR 276.00
  • EUR 3082.80
  • EUR 393.60
  • 10 ug
  • 1 mg
  • 50 ug

Influenza B virus (B/Florida/4/2006) HA protein, His Tag

E40VAG015 20ug
EUR 495

Florida 0704

iha-026 10µg
EUR 60
Description: Influenza B Virus Florida 0704

Florida 0406

iha-027 10µg
EUR 60
Description: Influenza B Virus Florida 0406

Influenza B Virus Florida 04/06 (purified virus, inactivated)

RP-1591 10 ug
EUR 270

Influenza B virus (B/Florida/4/2006) HA Protein (HA1 Subunit), His Tag

E40VAG014 20ug
EUR 495

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Chikungunya virus (CHIKV) by ELISA

530-400-CUX Custom Ask for price