Is Florida Testing For Viruse And Antibody Results

IHC Detection Kit for Mouse and Rabbit IgG Primary Antibody

abx091013-100l 100 µl
EUR 987.5

Human IgG antibody Laboratories manufactures the is florida testing for viruse and antibody results reagents distributed by Genprice. The Is Florida Testing For Viruse And Antibody Results reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact virus Antibody. Other Is products are available in stock. Specificity: Is Category: Florida Group: Testing For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Testing For information

TruStrip RDT Aflatoxin B1 rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100290-RDT 1 pk Ask for price

TruStrip RDT Aflatoxin M1 rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100330-RDT 1 pk Ask for price

Influenza-B Virus Florida 07/04

rAP-5412 Inquiry Ask for price

Influenza-B Virus Florida 04/06

rAP-5413 Inquiry Ask for price

TruStrip RDT Chloramphenicol rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100040-RDT 1 pk
EUR 781.2

TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100060-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (AHD rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100070-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (SEM) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100075-RDT 1 pk Ask for price

TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100080-RDT 1 pk
EUR 781.2

TruStrip RDT Malachite green rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100280-RDT 1 pk Ask for price

TruStrip RDT Total Aflatoxins rapid test strips, results is 2-10 mins, 50 strips/pk

DE-100300-RDT 1 pk Ask for price

Influenza B Virus Florida 07 / 04 Protein

20-abx260511
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 ug
  • 1 mg
  • 50 ug

Influenza B Virus Florida 04 / 06 Protein

20-abx260512
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 ug
  • 1 mg
  • 50 ug

Influenza B Virus Florida 07 / 04 Protein

abx260511-10g 10 µg
EUR 325

Influenza B Virus Florida 07 / 04 Protein

abx260511-2g 2 µg
EUR 225

Influenza B Virus Florida 04 / 06 Protein

abx260512-10g 10 µg
EUR 325

Influenza B Virus Florida 04 / 06 Protein

abx260512-2g 2 µg
EUR 225