Custom ELISA testing for anthrax antibodies in animal and human samples (vaccinated or normal) |
900-100-CUX |
Alpha Diagnostics |
Custom |
Ask for price |
Human IgG antibody Laboratories manufactures the is florida testing for viruse and antibody results reagents distributed by Genprice. The Is Florida Testing For Viruse And Antibody Results reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact virus Antibody. Other Is products are available in stock. Specificity: Is Category: Florida Group: Testing For
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Testing For information
Influenza B Virus Florida 04/06 |
7-07923 |
CHI Scientific |
1mg |
Ask for price |
TruStrip RDT Chloramphenicol rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100040-RDT |
Alpha Diagnostics |
1 pk |
EUR 781.2 |
TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100060-RDT |
Alpha Diagnostics |
1 pk |
Ask for price |
TruStrip RDT Nitrofuran (AHD rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100070-RDT |
Alpha Diagnostics |
1 pk |
Ask for price |
TruStrip RDT Nitrofuran (SEM) rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100075-RDT |
Alpha Diagnostics |
1 pk |
Ask for price |
TruStrip RDT Nitrofuran (AOZ) rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100080-RDT |
Alpha Diagnostics |
1 pk |
EUR 781.2 |
TruStrip RDT Malachite green rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100280-RDT |
Alpha Diagnostics |
1 pk |
Ask for price |
TruStrip RDT Total Aflatoxins rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100300-RDT |
Alpha Diagnostics |
1 pk |
Ask for price |
TruStrip RDT Sulfonamides residues (SAs) rapid test strips, results is 2-10 mins, 50 strips/pk |
DE-100090-RDT |
Alpha Diagnostics |
1 pk |
EUR 781.2 |
Influenza B Virus Florida 07 / 04 Protein |
20-abx260511 |
Abbexa |
-
EUR 276.00
-
EUR 3082.80
-
EUR 393.60
|
|
|
Influenza B Virus Florida 04 / 06 Protein |
20-abx260512 |
Abbexa |
-
EUR 276.00
-
EUR 3082.80
-
EUR 393.60
|
|
|
Influenza B virus (B/Florida/4/2006) HA protein, His Tag |
E40VAG015 |
EnoGene |
20ug |
EUR 495 |
Florida 0704 |
iha-026 |
ProSpec Tany |
10µg |
EUR 60 |
Description: Influenza B Virus Florida 0704 |
Florida 0406 |
iha-027 |
ProSpec Tany |
10µg |
EUR 60 |
Description: Influenza B Virus Florida 0406 |
Influenza B Virus Florida 04/06 (purified virus, inactivated) |
RP-1591 |
Alpha Diagnostics |
10 ug |
EUR 270 |
Influenza B virus (B/Florida/4/2006) HA Protein (HA1 Subunit), His Tag |
E40VAG014 |
EnoGene |
20ug |
EUR 495 |
Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Chikungunya virus (CHIKV) by ELISA |
530-400-CUX |
Alpha Diagnostics |
Custom |
Ask for price |