Is Florida Testing For Viruse And Antibody Results

Custom ELISA testing for anthrax antibodies in animal and human samples (vaccinated or normal)
900-100-CUX Custom Ask for price

Human IgG antibody Laboratories manufactures the is florida testing for viruse and antibody results reagents distributed by Genprice. The Is Florida Testing For Viruse And Antibody Results reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact virus Antibody. Other Is products are available in stock. Specificity: Is Category: Florida Group: Testing For

Human Centriole and Centrosome Antibody IgG ELISA Kit
48-Strip-Wells
EUR 550

Human Centriole and Centrosome Antibody IgG ELISA Kit
5x96-Strip-Wells
EUR 3420

Human Centriole and Centrosome Antibody IgG ELISA Kit
96-Strip-Wells
EUR 765

ELISA kit for Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG)
48T
EUR 464.4
Description: Quantitative sandwich ELISA for measuring Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG)
5 plates of 96 wells
EUR 3248.4
Description: Quantitative sandwich ELISA for measuring Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG)
96T
EUR 816
Description: Quantitative sandwich ELISA for measuring Pig Antibody against Foot and Mouth Disease IgG (FMDV-Ab-IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Testing For information

TruStrip RDT Malachite green rapid test strips, results is 2-10 mins, 50 strips/pk
DE-100280-RDT 1 pk Ask for price

TruStrip RDT Total Aflatoxins rapid test strips, results is 2-10 mins, 50 strips/pk
DE-100300-RDT 1 pk Ask for price

TruStrip RDT Sulfonamides residues (SAs) rapid test strips, results is 2-10 mins, 50 strips/pk
DE-100090-RDT 1 pk
EUR 781.2

Rabbit anti-Influenza B virus (B/Florida/4/2006) NP Polyclonal Antibody
MBS7149494-INQUIRE INQUIRE Ask for price

Influenza B virus (Florida) Antigen
INB-329 1 vial
EUR 798.4
Description: Protein

Influenza B virus (Florida) Antigen
VAC-0157 0.5ml
EUR 2398.4
Description: Protein

Influenza B Virus Florida 07/04
7-07918 10µg Ask for price

Influenza B Virus Florida 07/04
7-07919 50µg Ask for price

Influenza B Virus Florida 07/04
7-07920 1mg Ask for price

Influenza B Virus Florida 04/06
7-07921 10µg Ask for price

Influenza B Virus Florida 04/06
7-07922 50µg Ask for price

Influenza B Virus Florida 04/06
7-07923 1mg Ask for price

Influenza B Virus Florida 07/04
MBS143234-001mg 0.01mg
EUR 240

Influenza B Virus Florida 07/04
MBS143234-005mg 0.05mg
EUR 310

Influenza B Virus Florida 07/04
MBS143234-1mg 1mg
EUR 2375

Influenza B Virus Florida 07/04
MBS143234-5x1mg 5x1mg
EUR 10370

Influenza B Virus Florida 04/06
MBS143235-001mg 0.01mg
EUR 240